Complex Family : 2ast
Query : Q6PEC4,RAT
  B2GUZ0,RAT
  B2RZ99,RAT
Selected Interface : 2astBC
No. of Contact Residue Pairs : 47
No. of Contact Residues in Chain 1 : 23
No. of Contact Residues in Chain 2 : 18
No. of Homologous Physical PPIs : 27
No. of Organisms : 9
MSA 2astB side  (Query 2)
   2astC side (Query 3)
Template-Based Homologous Protein-Protein Interactions of 2astBC from Multiple Species
Organism Z-value Rank 2astB side (Query 2) 2astC side (Query 3)
uniprot AC Sequence Identity E-value
-log10()
uniprot AC Sequence Identity E-value
-log10()
Homo sapiens 5.348 1 Q13309 1.00 163.00 A6NHZ8 0.95 32.15
Homo sapiens 5.269 2 Q13309 1.00 163.00 P61024 1.00 33.09
Homo sapiens 5.269 3 Q13309 1.00 163.00 Q5T179 1.00 26.52
Homo sapiens 5.269 4 Q13309 1.00 163.00 Q9BZU3 0.94 24.00
Homo sapiens 4.408 5 Q13309 1.00 163.00 P33552 0.84 26.52
Mus musculus 5.197 1 Q9Z0Z3 0.84 138.00 P61025 1.00 33.09
Mus musculus 5.197 2 Q9Z0Z3 0.84 138.00 Q9D108 0.98 32.69
Mus musculus 4.589 3 Q9Z0Z3 0.84 138.00 Q3UNC9 0.92 29.00
Mus musculus 4.358 4 Q9Z0Z3 0.84 138.00 P56390 0.84 26.69
Rattus norvegicus 5.197 1 B2GUZ0 0.85 141.00 B2RZ99 1.00 33.09
Rattus norvegicus 4.358 2 B2GUZ0 0.85 141.00 B1WC51 0.84 26.69
Bos taurus 5.269 1 A7MB09 0.88 148.00 Q0P5A5 1.00 33.09
Bos taurus 4.408 2 A7MB09 0.88 148.00 Q2KJI1 0.84 26.52
Danio rerio 4.643 1 A3KP53 0.46 73.30 Q6DEL8 0.92 31.09
Danio rerio 4.324 2 A3KP53 0.46 73.30 Q6IQC3 0.79 24.69
Danio rerio 3.604 3 A3KP53 0.46 73.30 Q1LX17 0.84 28.04
Anopheles gambiae str. PEST 4.610 1 Q7QI50 0.35 39.52 Q7QFX2 0.76 23.52
Anopheles gambiae str. PEST 4.134 2 Q7QI50 0.35 39.52 Q7PTN0 0.82 27.52
Nematostella vectensis 4.242 1 A7RTZ4 0.32 25.69 A7S6M4 0.78 22.69
Nematostella vectensis 4.088 2 A7RTZ4 0.32 25.69 A7SPG3 0.74 23.04
Nematostella vectensis 3.206 3 A7RTZ4 0.32 25.69 A7RSA5 0.63 19.00
Drosophila pseudoobscura pseudoobscura 4.000 1 Q295F1 0.34 43.69 B5DH81 0.80 26.30
Drosophila pseudoobscura pseudoobscura 3.298 2 Q295F1 0.34 43.69 Q294K5 0.74 23.69
Aedes aegypti 4.313 1 Q17B56 0.33 39.09 Q0IFN1 0.83 27.39
Aedes aegypti 4.313 2 Q17B55 0.33 39.09 Q0IFN1 0.83 27.39
Aedes aegypti 3.788 3 Q17B56 0.33 39.09 Q17AP8 0.73 23.00
Aedes aegypti 3.788 4 Q17B55 0.33 39.09 Q17AP8 0.73 23.00

2astB side (Query 2)
                                 2140      2150      2160      2170                              2180              2190      2200      2210      2220      2230      2240      2250      2260      2270      2280      2290      2300      2310      2320      2330      2340      2350      2360      2370      2380      2390      2400      2410      
2ast-B                       LWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQP----LA-----EH----------FS-----P--------FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ

Query 2                      LWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQP----LG-----ES----------FS-----S--------FRVQHMDLSNSVINVSNLHGILSECSKLQNLSLEGLQLSDPIVTTLAQNENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPDTLTQLNLSGYRKNLQKTDLCTLIKRCPNLVRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLREALPRLQINCAYFTSIARPTMDNKKNPEIWGIKCRLTLQ

Q13309   9606     PRI  136 : LWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQP----LA-----EH----------FS-----P--------FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ

Q9Z0Z3   10090    ROD  136 : LWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQP----LG-----ES----------FS-----S--------FRVQHMDLSNSVINVSNLHKILSECSKLQNLSLEGLQLSDPIVKTLAQNENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPNTITQLNLSGYRKNLQKTDLCTIIKRCPNLIRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPDTLLELGEIPTLKTLQVFGIVPEGTLQLLREALPRLQINCAYFTTIARPTMDSKKNLEIWGIKCRLTLQ
B2GUZ0   10116    ROD  136 : LWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQP----LG-----ES----------FS-----S--------FRVQHMDLSNSVINVSNLHGILSECSKLQNLSLEGLQLSDPIVTTLAQNENLVRLNLCGCSGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPDTLTQLNLSGYRKNLQKTDLCTLIKRCPNLVRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLREALPRLQINCAYFTSIARPTMDNKKNPEIWGIKCRLTLQ

A7MB09   9913     MAM  136 : LWQTVDLAGRNLYPDVVGRLLSRGVVAFRCPRSFMDQP----LV-----EH----------FS-----P--------FRLQHLDLSNSVIDASTLHGLLSHCSKLQNLSLEGLRLSDPVVDNLAQNTNLLRLNLSGCSGFSESALKTLLSSCSRLDELNLSWCYDFTEKHVQMAVAHVSKTITQLNLSGYRKNLQRSDVSTLVGRCPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLSLE

A3KP53   7955     VRT  127 : LWHSVDLVGKAQLDAELGQVLSAGVLRLRCPHTCIGQP----SF-----KS----------TP-----S--------LRVQHLDFSNCTVETSVLEDVLSRCKHLQNLSLEGLVLSDNIIYSLAQNPEIIRLNLCGCSGFSPESLTEMLTACTRIEEMNVSWC-DFSNLHIQAIASNIPSSVSQLNISGYRQNLTMEDVKAIVKRCPNITDLDLSDSVLVTTDSFPVLQQLSSLRHLGLSRCYQIHPASLIDFEKFLNLQTLEVFGLIQDSYLPILCKSLPHIQINTQPFSTVARPTSSSRKDRTLWGMHCRLVYK

Q7QI50   180454   INV  109 : LWYRLDLSNRTLQFDGLVEVLSRGVIVLRLAQTSIVNP----TPDSNYLEF----------PA-----C--------IKVQYLDLSMCTVSLAVLGALLANCRALVKLSLENVPLDGRICAEIAENRKLEALNLTMCSGIDATGMRLMAKALTRLHSLNVSWT-SLSAEAVQELVRNLTPQIVHLNLSGCRSTLTDEKVAVLIKRCTKLVALDLSDCTPLTEVVIKTLCKARKIEYLSLSRCYNIPVTAYLNLTELKTLRFLDLFGLVSDQAIATLKNSLVDIGINKYYHSSVARPTVGTKRTS-IWGLRTR----
A7RTZ4   45351    INV  42  : LWLTVDMSKAKLQHGLLGRILLRGTRVMRIASSRVCSP----LL-----DENLGILPGVAPLS-----PSMAACNSLFRLTYLDATLCTFEDSTLLTLLLHSRRLRCLSLDSSNLSLSILRAIGDCHDLEVLNLAMCTGITLQGVKALVNGCKRLTHLNLAWTHLSKESIIQVV--QNLPLLRQLNLSGSRETMTDEAVLHLISNCIHLTHLDLSDCILITARSLLAIIQETKIEHLALSRCYNIPPQAFSLCVELKSLAKLDVYGLLNGDGVEILKRQLPDTFINSCLFSTIARP-VDSKYRGTIWGIRCQ----
Q295F1   46245    INV  274 : LWTRLDLGLRTLRPAALEQIVRRGVLVLRLAQANIQEPAFTPLA-----SD----------FK-----S---------RLQYLDLSMTSISRVSLRSLMSQCRQLKKLSLENAELSDEICAEIAKNKSLEALNLTMASGLTARSVRLMMESLTNLSSLNISWT-DLSADAVTALVTHISPNVIRLNVAGCRRVLFDSHVKSLQSRCPQLLELDLSDCNSLTPAAIEAIMQFQMLEYLSVSRCYLIPAASFIELKDMSSLTYLDIFGMLSDGAMEALEQQMPKMGINKFIHSSVSRPTVGSRRT-SIWGLRTR----
Q17B56   7159     INV  187 : LWARLDLSCRSLREGALGRVISRGTVILRLAQAHVSNP----VF-----TY----------GSVDLSYE--------TKLRFLDLSMCSIDQGTLCELLSHCRSLRKLSLENVPVDTECCREIACNVHLEALNLTMCEGLDNFNVTLLIKKLTKLHSLNISWT-QLSRSTVDSLVTHVTPTLLRLNIAGCRNSMTDAALLKLIDRCPDLLELDLSDCTQLSSEAMKIVCKLKKLEYLSLSRCYNINVTSYLQLGAIEPLQFLDIFGLLSEPALAMLQTSFPGVGINKFMHSSVARPTVGSRRT-SIWGLRTR----
Q17B55   7159     INV  110 : LWARLDLSCRSLREGALGRVISRGTVILRLAQAHVSNP----VF-----TY----------GSVDLSYE--------TKLRFLDLSMCSIDQGTLCELLSHCRSLRKLSLENVPVDTECCREIACNVHLEALNLTMCEGLDNFNVTLLIKKLTKLHSLNISWT-QLSRSTVDSLVTHVTPTLLRLNIAGCRNSMTDAALLKLIDRCPDLLELDLSDCTQLSSEAMKIVCKLKKLEYLSLSRCYNINVTSYLQLGAIEPLQFLDIFGLLSEPALAMLQTSFPGVGINKFMHSSVARPTVGSRRT-SIWGLRTR----

2astC side (Query 3)
                                  3010       3020      3030      3040      3050      3060      3070
2ast-C                       QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL

Query 3                      QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL

A6NHZ8   9606     PRI  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPETHLMSESEWRNLGIQQSQGWVHYMIHEPEPHVLLFRRPL
P61024   9606     PRI  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
Q5T179   9606     PRI  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEP-----------
Q9BZU3   9606     PRI  1   : -------------MRTRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
P33552   9606     PRI  5   : QIYYSDKY-FDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPL

P61025   10090    ROD  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
Q9D108   10090    ROD  5   : QIYYSDKY-DDKEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
Q3UNC9   10090    ROD  22  : QIYYSDKY-DDEEFEYRHVMLPKDIDKLVPKTHLMSESEWRKLGVQQSQGWVHYMIHEPELHILLFQWPL
P56390   10090    ROD  5   : QIYYSDKY-FDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPL
B2RZ99   10116    ROD  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
B1WC51   10116    ROD  5   : QIYYSDKY-FDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPL

Q0P5A5   9913     MAM  5   : QIYYSDKY-DDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPL
Q2KJI1   9913     MAM  5   : QIYYSDKY-FDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPL

Q6DEL8   7955     VRT  5   : QIYYSDKY-DDDKFEYRHVMLPKDIAKRVPKTHLMSETEWRNLGVQQSQGWVHYMIHQPEPHILLFRRPL
Q6IQC3   7955     VRT  5   : QIYYSDKY-TDDHFEYRHVVLPRELAKQVPKSHLMSEDECRRLGVQQSLGWVHYMIHEPESHILLFRRPL
Q1LX17   7955     VRT  7   : QIYYSDKY-SDEEYEYRHVMLPKQLSKLVPSSHLMSEEEWRGLGVQQSQGWIHYMIHKPEPHILLFRRPL

Q7QFX2   180454   INV  5   : QIQYSEKY-YDDVYEYRHVILPPDLAKYVPKTHLMTETEWRNLGVQQSPGWVLYMIHSPEPHVLLFRRP-
Q7PTN0   180454   INV  6   : -IYYSDKY-YDDEYEYRHVVLPKDIAKLVPKTHLMTENEWRAIGVQQSRGWVHYMVHQPEPHILLFRRPI
A7S6M4   45351    INV  14  : -----EKY-FDEYFEYRHVMLPKELVSQVPSVHLMTESEWRNLGVQQSPGWVHYLIHEPEPHVLLFRRPL
A7SPG3   45351    INV  6   : QIYYSEKY-FDSQYEYRHVMVPKDIAKLVPRKKLMTESEWRQIGIQQSQGWQHYMHHHPEPHIILFRR--
A7RSA5   45351    INV  5   : -IFYSTKYEDDTGYEYRHVIVPKVLAKKIPKDRLMREDEWRGMGIQQSQGWQQYMIHHPEPHVLLFKRPV
B5DH81   46245    INV  5   : -IYYSDKY-YDEKFEYRHVVLPKELVKLVPKTHLMTETEWRSIGVQQSRGWIHYMIHKPEPHILLFRRP-
Q294K5   46245    INV  5   : QIQYSEKY-FDDKFEYRHVILPSDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMMHAPEPHVILFRR--
Q0IFN1   7159     INV  6   : -IYYSDKY-YDDEYEYRHVVLPKDIAKLVPKTHLMTENEWRSIGVQQSRGWIHYMIHQPEPHILLFRRP-
Q17AP8   7159     INV  5   : QIQYSEKY-YDDVYEYRHVILPPDLARNVPKSHLMTETEWRNLGVQQSPGWVMYMMHAPEPHILLFRRP-

Description
Template
(structure)
Contact residues: Marked by 4 colors
Hydrogen-bond residues: green Conserved residues:orange Both:yellow Others:gray