Complex Family : 1eer
Query : P07321,Mus
  P14753,Mus
  P14753,Mus
Selected Interface : 1eerAC
No. of Contact Residue Pairs : 40
No. of Contact Residues in Chain 1 : 16
No. of Contact Residues in Chain 2 : 19
No. of Homologous Physical PPIs : 6
No. of Organisms : 3
MSA 1eerA side  (Query 1)
   1eerC side (Query 2)
Template-Based Homologous Protein-Protein Interactions of 1eerAC from Multiple Species
Organism Z-value Rank 1eerA side (Query 1) 1eerC side (Query 2)
uniprot AC Sequence Identity E-value
-log10()
uniprot AC Sequence Identity E-value
-log10()
Homo sapiens 4.337 1 P01588 0.96 88.39 P19235 0.98 117.00
Mus musculus 4.141 1 P07321 0.77 69.69 P14753 0.82 95.22
Mus musculus 4.141 2 B7ZMY9 0.76 67.69 P14753 0.82 95.22
Rattus norvegicus 4.141 1 P29676 0.79 71.00 O35545 0.82 96.30
Rattus norvegicus 4.141 2 P29676 0.79 71.00 Q07303 0.82 96.30
Rattus norvegicus 4.141 3 P29676 0.79 71.00 Q5FVS4 0.82 96.15

1eerA side (Query 1)
                                      10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160    
1eer-A                       APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVKSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISNSDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Query 1                      APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLKLYTGEVCRRGDR

P01588   9606     PRI  28  : APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

P07321   10090    ROD  27  : APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLKLYTGEVCRRGDR
B7ZMY9   10090    ROD  27  : APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLHIDKAISGLRSLTSLLRVLGAQ-ELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLKLYTGEVCRRGDR
P29676   10116    ROD  27  : APPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

1eerC side (Query 2)
                               10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220
1eer-C                       DPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSEWSEPVSLLT

Query 2                      DPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMD-FNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLT

P19235   9606     PRI  32  : DPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLT

P14753   10090    ROD  32  : DPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMD-FNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLT
O35545   10116    ROD  32  : DPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMG-FNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLT
Q07303   10116    ROD  32  : DPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMG-FNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLT
Q5FVS4   10116    ROD  32  : DPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMG-FNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLT

Description
Template
(structure)
Contact residues: Marked by 4 colors
Hydrogen-bond residues: green Conserved residues:orange Both:yellow Others:gray